Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Primary Antibodies   >   Stem Cells   >   RHAMM Antibody   

RHAMM Antibody

     
  • WB - RHAMM Antibody ASC11285
    Western blot analysis of RHAMM in rat stomach tissue lysate with RHAMM antibody at 1 µg/mL.
  • IHC - RHAMM Antibody ASC11285
    Immunohistochemistry of RHAMM in human stomach tissue with RHAMM antibody at 2.5 µg/mL.
  • IF - RHAMM Antibody ASC11285
    Immunofluorescence of RHAMM in human stomach tissue with RHAM antibody at 20 µg/mL.
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Application
  • Applications Legend:
  • WB=Western Blot
  • IHC=Immunohistochemistry
  • IHC-P=Immunohistochemistry (Paraffin-embedded Sections)
  • IHC-F=Immunohistochemistry (Frozen Sections)
  • IF=Immunofluorescence
  • FC=Flow Cytopmetry
  • IC=Immunochemistry
  • ICC=Immunocytochemistry
  • E=ELISA
  • IP=Immunoprecipitation
  • DB=Dot Blot
  • CHIP=Chromatin Immunoprecipitation
  • FA=Fluorescence Assay
  • IEM=Immunoelectronmicroscopy
  • EIA=Enzyme Immunoassay
WB, IHC-P, IF, E
Primary Accession O75330
Other Accession NP_036617, 217272802
Reactivity Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Isotype IgG
Application Notes RHAMM antibody can be used for detection of RHAMM by Western blot at 1 µg/mL. Antibody can also be used for immunohistochemistry starting at 2.5 µg/mL. For immunofluorescence start at 5 µg/mL.
Additional Information
Gene ID 3161
Target/Specificity HMMR;
Reconstitution & Storage RHAMM antibody can be stored at 4℃ for three months and -20℃, stable for up to one year. As with all antibodies care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures.
PrecautionsRHAMM Antibody is for research use only and not for use in diagnostic or therapeutic procedures.
Protein Information
Name HMMR
Synonyms IHABP, RHAMM
Function Involved in cell motility. When hyaluronan binds to HMMR, the phosphorylation of a number of proteins, including PTK2/FAK1 occurs. May also be involved in cellular transformation and metastasis formation, and in regulating extracellular- regulated kinase (ERK) activity.
Cellular Location Cell surface. Cytoplasm.
Tissue Location Expressed in breast cancer cell lines and in normal breast tissue EMBL; U29343; AAC52049.1; -; mRNA EMBL; AF032862; AAC32548.1; -; mRNA EMBL; AK290577; BAF83266.1; -; mRNA EMBL; AK303616; BAG64626.1; -; mRNA EMBL; AC112205; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; CH471062; EAW61522.1; -; Genomic_DNA EMBL; CH471062; EAW61523.1; -; Genomic_DNA EMBL; CH471062; EAW61524.1; -; Genomic_DNA EMBL; CH471062; EAW61525.1; -; Genomic_DNA EMBL; BC108904; AAI08905.1; -; mRNA CCDS; CCDS4362.1; -. [O75330-1] CCDS; CCDS4363.1; -. [O75330-2] CCDS; CCDS47334.1; -. [O75330-3] CCDS; CCDS47335.1; -. [O75330-4] PIR; JC5016; JC5016 RefSeq; NP_001136028.1; NM_001142556.1. [O75330-3] RefSeq; NP_001136029.1; NM_001142557.1. [O75330-4] RefSeq; NP_036616.2; NM_012484.2. [O75330-1] RefSeq; NP_036617.2; NM_012485.2. [O75330-2] UniGene; Hs.740467; - ProteinModelPortal; O75330; - SMR; O75330; - BioGrid; 109404; 47 DIP; DIP-56496N; - IntAct; O75330; 27 MINT; MINT-4989385; - STRING; 9606.ENSP00000377492; - DrugBank; DB08818; Hyaluronic acid iPTMnet; O75330; - PhosphoSitePlus; O75330; - BioMuta; HMMR; - REPRODUCTION-2DPAGE; O75330; - EPD; O75330; - MaxQB; O75330; - PaxDb; O75330; - PeptideAtlas; O75330; - PRIDE; O75330; - Ensembl; ENST00000353866; ENSP00000185942; ENSG00000072571. [O75330-2] Ensembl; ENST00000358715; ENSP00000351554; ENSG00000072571. [O75330-1] Ensembl; ENST00000393915; ENSP00000377492; ENSG00000072571. [O75330-3] Ensembl; ENST00000432118; ENSP00000402673; ENSG00000072571. [O75330-4] GeneID; 3161; - KEGG; hsa:3161; - UCSC; uc003lzf.5; human. [O75330-1] CTD; 3161; - DisGeNET; 3161; - GeneCards; HMMR; - H-InvDB; HIX0032412; - HGNC; HGNC:5012; HMMR HPA; CAB002433; - HPA; HPA040025; - HPA; HPA043926; - MalaCards; HMMR; - MIM; 600936; gene neXtProt; NX_O75330; - OpenTargets; ENSG00000072571; - PharmGKB; PA29340; - eggNOG; ENOG410IJ28; Eukaryota eggNOG; ENOG4111G1K; LUCA GeneTree; ENSGT00390000007135; - HOVERGEN; HBG044411; - InParanoid; O75330; - KO; K06267; - OMA; NCSALME; - OrthoDB; EOG091G03MO; - PhylomeDB; O75330; - TreeFam; TF333963; - BioCyc; ZFISH:ENSG00000072571-MONOMER; - Reactome; R-HSA-2160916; Hyaluronan uptake and degradation Reactome; R-HSA-8854518; AURKA Activation by TPX2 GeneWiki; Hyaluronan-mediated_motility_receptor; - GenomeRNAi; 3161; - PRO; PR:O75330; - Proteomes; UP000005640; Chromosome 5 Bgee; ENSG00000072571; - CleanEx; HS_HMMR; - ExpressionAtlas; O75330; baseline and differential Genevisible; O75330; HS GO; GO:0009986; C:cell surface; IEA:UniProtKB-SubCell GO; GO:0005829; C:cytosol; TAS:Reactome GO; GO:0016020; C:membrane; IDA:UniProtKB GO; GO:0005886; C:plasma membrane; TAS:Reactome GO; GO:0005540; F:hyaluronic acid binding; IBA:GO_Central GO; GO:0000086; P:G2/M transition of mitotic cell cycle; TAS:Reactome GO; GO:0030214; P:hyaluronan catabolic process; TAS:Reactome InterPro; IPR031794; HMMR_C InterPro; IPR031787; HMMR_N InterPro; IPR026203; IHABP PANTHER; PTHR18956; PTHR18956; 1 Pfam; PF15908; HMMR_C; 1 Pfam; PF15905; HMMR_N; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Cytoplasm; Glycoprotein; Hyaluronic acid; Phosphoprotein; Polymorphism; Reference proteome; Repeat CHAIN 1 724 Hyaluronan mediated motility receptor /FTId=PRO_0000084007 REGION 635 645 Hyaluronic acid-binding. REGION 657 666 Hyaluronic acid-binding. MOD_RES 20 20 Phosphoserine MOD_RES 703 703 Phosphothreonine CARBOHYD 133 133 N-linked (GlcNAc...). CARBOHYD 477 477 N-linked (GlcNAc...). CARBOHYD 567 567 N-linked (GlcNAc...). CARBOHYD 588 588 N-linked (GlcNAc...). VAR_SEQ 1 90 MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKS QRFKQQKESKQNLNVDKDTTLPASARKVKSSESKESQKNDK DLKILEKE -> MTLL (in isoform 4) /FTId=VSP_041266 VAR_SEQ 75 75 K -> KK (in isoform 3) /FTId=VSP_038378 VAR_SEQ 76 90 Missing (in isoform 2) /FTId=VSP_004286 VARIANT 92 92 R -> C (in dbSNP:rs299284) /FTId=VAR_024155 VARIANT 305 305 N -> K (in dbSNP:rs2303077) /FTId=VAR_031661 VARIANT 320 320 N -> K (in dbSNP:rs2303077) /FTId=VAR_056917 VARIANT 332 332 R -> H (in dbSNP:rs2303078) /FTId=VAR_024156 VARIANT 368 368 V -> A (in dbSNP:rs299290) /FTId=VAR_020044 VARIANT 484 484 A -> V (in dbSNP:rs299295) /FTId=VAR_024157 VARIANT 557 557 D -> H (in dbSNP:rs2230362) /FTId=VAR_056918 VARIANT 595 595 L -> I (in dbSNP:rs2230363) /FTId=VAR_056919 CONFLICT 103 103 R -> S (in Ref. 2; AAC32548) CONFLICT 277 277 E -> D (in Ref. 1; AAC52049) CONFLICT 298 298 K -> T (in Ref. 1; AAC52049) CONFLICT 322 322 K -> E (in Ref. 1; AAC52049) CONFLICT 330 332 QER -> REH (in Ref. 1; AAC52049) CONFLICT 547 547 Q -> R (in Ref. 3; BAF83266) SEQUENCE 724 AA; 84100 MW; F2C3C0DBA863955F CRC64; MSFPKAPLKR FNDPSGCAPS PGAYDVKTLE VLKGPVSFQK SQRFKQQKES KQNLNVDKDT TLPASARKVK SSESKESQKN DKDLKILEKE IRVLLQERGA QDRRIQDLET ELEKMEARLN AALREKTSLS ANNATLEKQL IELTRTNELL KSKFSENGNQ KNLRILSLEL MKLRNKRETK MRGMMAKQEG MEMKLQVTQR SLEESQGKIA QLEGKLVSIE KEKIDEKSET EKLLEYIEEI SCASDQVEKY KLDIAQLEEN LKEKNDEILS LKQSLEENIV ILSKQVEDLN VKCQLLEKEK EDHVNRNREH NENLNAEMQN LKQKFILEQQ EREKLQQKEL QIDSLLQQEK ELSSSLHQKL CSFQEEMVKE KNLFEEELKQ TLDELDKLQQ KEEQAERLVK QLEEEAKSRA EELKLLEEKL KGKEAELEKS SAAHTQATLL LQEKYDSMVQ SLEDVTAQFE SYKALTASEI EDLKLENSSL QEKAAKAGKN AEDVQHQILA TESSNQEYVR MLLDLQTKSA LKETEIKEIT VSFLQKITDL QNQLKQQEED FRKQLEDEEG RKAEKENTTA ELTEEINKWR LLYEELYNKT KPFQLQLDAF EVEKQALLNE HGAAQEQLNK IRDSYAKLLG HQNLKQKIKH VVKLKDENSQ LKSEVSKLRC QLAKKKQSET KLQEELNKVL GIKHFDPSKA FHHESKENFA LKTPLKEGNT NCYRAPMECQ ESWK
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

RHAMM Antibody: The hyaluronan-mediated motility receptor, also known as RHAMM, was initially identified as a soluble protein that could be released by sub-confluent migrating cells, promoting cell motility and invasion via interactions with hyaluronan (HA) and the cell surface. While RHAMM is normally poorly expressed in most normal tissues and is not required for embryonic development or normal cell homeostasis functions, its expression is increased during wound repair in response to hypoxia and fibrogenic factors. However, its overexpression is transforming in multiple types of cancers and is required for maintaining RAS transformation. RHAMM associates with BRCA1 and BARD1, attenuating the mitotic-spindle-promoting activity of RHAMM, which may contribute to tumor progression by promoting genomic instability.

References

Hardwick C, Hoare K, Owens R, et al. Molecular cloning of a novel hyaluronan receptor that promotes tumor cell motility. J. Cell Biol. 1992; 117:1343-50.
Samuel SK, Hurta RA, Spearman MA, et al. TGF-beta 1 stimulation of cell locomotion utilizes the hyaluronan receptor RHAMM and hyaluronan. J. Cell Biol. 1993; 123:749-58.
Hall CL, Yang B, Yang X, et al. Overexpression of the hyaluronan receptor RHAMM is transforming and is also required for H-ras transformation. Cell 1995; 82:19-26.
Maxwell CA, McCarthy J, and Turley E. Cell-surface and mitotic-spindle RHAMM: moonlighting or dual oncogenic functions? J. Cell Sci. 2008; 121:925-32.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 320.00
Cat# ASC11285
Size:
Quantity:
Availability: 5-7days
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
30% off on 2,800+ Neuroscience Antibodies. PromoCode:<span class=text-red> FLASH20
Terms & Conditions