Register or Login
All
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   ADAM8 Antibody (N-term) Blocking peptide   

ADAM8 Antibody (N-term) Blocking peptide

Synthetic peptide

     
  • SPECIFICATION
  • CITATIONS
  • PROTOCOLS
  • BACKGROUND
Product Information
Primary Accession P78325
Clone Names 100507048
Peptide ID 100507048
Additional Information
Other Names Disintegrin and metalloproteinase domain-containing protein 8, ADAM 8, 3424-, Cell surface antigen MS2, CD156a, ADAM8, MS2
Target/Specificity The synthetic peptide sequence used to generate the antibody AP14058a was selected from the N-term region of ADAM8. A 10 to 100 fold molar excess to antibody is recommended. Precise conditions should be optimized for a particular assay.
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name ADAM8
Synonyms MS2
Function Possible involvement in extravasation of leukocytes.
Cellular Location Membrane; Single-pass type I membrane protein
Tissue Location Expressed on neutrophils and monocytes. EMBL; D26579; BAA05626.1; -; mRNA EMBL; AK301147; BAG62738.1; -; mRNA EMBL; AL592071; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC064500; -; NOT_ANNOTATED_CDS; mRNA CCDS; CCDS31319.2; -. [P78325-1] CCDS; CCDS58102.1; -. [P78325-2] CCDS; CCDS58103.1; -. [P78325-3] RefSeq; NP_001100.3; NM_001109.4. [P78325-1] RefSeq; NP_001157961.1; NM_001164489.1. [P78325-3] RefSeq; NP_001157962.1; NM_001164490.1. [P78325-2] UniGene; Hs.501574; - PDB; 4DD8; X-ray; 2.10 A; A/B/C/D=196-403 PDBsum; 4DD8; - ProteinModelPortal; P78325; - SMR; P78325; - BioGrid; 106615; 1 CORUM; P78325; - IntAct; P78325; 2 STRING; 9606.ENSP00000453302; - BindingDB; P78325; - ChEMBL; CHEMBL5665; - GuidetoPHARMACOLOGY; 1656; - MEROPS; M12.208; - iPTMnet; P78325; - PhosphoSitePlus; P78325; - BioMuta; ADAM8; - DMDM; 408359955; - MaxQB; P78325; - PaxDb; P78325; - PeptideAtlas; P78325; - PRIDE; P78325; - ProteomicsDB; 57567; - Ensembl; ENST00000415217; ENSP00000453855; ENSG00000151651. [P78325-3] Ensembl; ENST00000445355; ENSP00000453302; ENSG00000151651. [P78325-1] Ensembl; ENST00000485491; ENSP00000453043; ENSG00000151651. [P78325-2] GeneID; 101; - KEGG; hsa:101; - UCSC; uc009ybi.4; human. [P78325-1] CTD; 101; - DisGeNET; 101; - EuPathDB; HostDB:ENSG00000151651.15; - GeneCards; ADAM8; - H-InvDB; HIX0035404; - HGNC; HGNC:215; ADAM8 HPA; HPA064637; - MIM; 602267; gene neXtProt; NX_P78325; - OpenTargets; ENSG00000151651; - eggNOG; KOG3607; Eukaryota eggNOG; ENOG410XX2M; LUCA GeneTree; ENSGT00910000144014; - HOVERGEN; HBG006978; - InParanoid; P78325; - KO; K06540; - OMA; DENVQGC; - OrthoDB; EOG091G01NX; - TreeFam; TF314733; - Reactome; R-HSA-1474228; Degradation of the extracellular matrix Reactome; R-HSA-6798695; Neutrophil degranulation ChiTaRS; ADAM8; human GeneWiki; ADAM8; - GenomeRNAi; 101; - PRO; PR:P78325; - Proteomes; UP000005640; Chromosome 10 Bgee; ENSG00000151651; - CleanEx; HS_ADAM8; - ExpressionAtlas; P78325; baseline and differential Genevisible; P78325; HS GO; GO:0071133; C:alpha9-beta1 integrin-ADAM8 complex; ISS:BHF-UCL GO; GO:0009986; C:cell surface; IDA:BHF-UCL GO; GO:0005737; C:cytoplasm; IDA:BHF-UCL GO; GO:0032127; C:dense core granule membrane; IDA:BHF-UCL GO; GO:0101003; C:ficolin-1-rich granule membrane; TAS:Reactome GO; GO:0005887; C:integral component of plasma membrane; IDA:BHF-UCL GO; GO:0032010; C:phagolysosome; IDA:BHF-UCL GO; GO:0005886; C:plasma membrane; IDA:BHF-UCL GO; GO:0002102; C:podosome; IDA:BHF-UCL GO; GO:0042581; C:specific granule; IDA:BHF-UCL GO; GO:0035579; C:specific granule membrane; TAS:Reactome GO; GO:0070820; C:tertiary granule; IDA:BHF-UCL GO; GO:0070821; C:tertiary granule membrane; TAS:Reactome GO; GO:0005509; F:calcium ion binding; ISS:BHF-UCL GO; GO:0050839; F:cell adhesion molecule binding; IPI:BHF-UCL GO; GO:0004222; F:metalloendopeptidase activity; IEA:InterPro GO; GO:0008237; F:metallopeptidase activity; IDA:BHF-UCL GO; GO:0043621; F:protein self-association; TAS:BHF-UCL GO; GO:0004252; F:serine-type endopeptidase activity; TAS:Reactome GO; GO:0008270; F:zinc ion binding; TAS:BHF-UCL GO; GO:0001525; P:angiogenesis; ISS:BHF-UCL GO; GO:0000902; P:cell morphogenesis; ISS:BHF-UCL GO; GO:0098609; P:cell-cell adhesion; IEA:Ensembl GO; GO:0071456; P:cellular response to hypoxia; IDA:BHF-UCL GO; GO:0022617; P:extracellular matrix disassembly; TAS:Reactome GO; GO:0006954; P:inflammatory response; IDA:BHF-UCL GO; GO:0002523; P:leukocyte migration involved in inflammatory response; ISS:BHF-UCL GO; GO:0048247; P:lymphocyte chemotaxis; ISS:BHF-UCL GO; GO:0043524; P:negative regulation of neuron apoptotic process; ISS:BHF-UCL GO; GO:0043312; P:neutrophil degranulation; TAS:Reactome GO; GO:0002675; P:positive regulation of acute inflammatory response; ISS:BHF-UCL GO; GO:0045780; P:positive regulation of bone resorption; ISS:BHF-UCL GO; GO:0045785; P:positive regulation of cell adhesion; ISS:BHF-UCL GO; GO:2000418; P:positive regulation of eosinophil migration; ISS:BHF-UCL GO; GO:2000415; P:positive regulation of fibronectin-dependent thymocyte migration; ISS:BHF-UCL GO; GO:0045089; P:positive regulation of innate immune response; ISS:BHF-UCL GO; GO:0043406; P:positive regulation of MAP kinase activity; ISS:BHF-UCL GO; GO:0051044; P:positive regulation of membrane protein ectodomain proteolysis; IDA:BHF-UCL GO; GO:2000391; P:positive regulation of neutrophil extravasation; IDA:BHF-UCL GO; GO:0051092; P:positive regulation of NF-kappaB transcription factor activity; ISS:BHF-UCL GO; GO:0051897; P:positive regulation of protein kinase B signaling; ISS:BHF-UCL GO; GO:0010954; P:positive regulation of protein processing; NAS:BHF-UCL GO; GO:0050714; P:positive regulation of protein secretion; IC:BHF-UCL GO; GO:0033089; P:positive regulation of T cell differentiation in thymus; ISS:BHF-UCL GO; GO:0070245; P:positive regulation of thymocyte apoptotic process; ISS:BHF-UCL GO; GO:2000309; P:positive regulation of tumor necrosis factor (ligand) superfamily member 11 production; ISS:BHF-UCL GO; GO:0022407; P:regulation of cell-cell adhesion; IDA:BHF-UCL CDD; cd04269; ZnMc_adamalysin_II_like; 1 Gene3D; 3.40.390.10; -; 1 Gene3D; 4.10.70.10; -; 1 InterPro; IPR006586; ADAM_Cys-rich InterPro; IPR018358; Disintegrin_CS InterPro; IPR001762; Disintegrin_dom InterPro; IPR036436; Disintegrin_dom_sf InterPro; IPR013032; EGF-like_CS InterPro; IPR000742; EGF-like_dom InterPro; IPR024079; MetalloPept_cat_dom_sf InterPro; IPR001590; Peptidase_M12B InterPro; IPR002870; Peptidase_M12B_N InterPro; IPR034027; Reprolysin_adamalysin Pfam; PF08516; ADAM_CR; 1 Pfam; PF00200; Disintegrin; 1 Pfam; PF01562; Pep_M12B_propep; 1 Pfam; PF01421; Reprolysin; 1 PRINTS; PR00289; DISINTEGRIN SMART; SM00608; ACR; 1 SMART; SM00050; DISIN; 1 SUPFAM; SSF57552; SSF57552; 1 PROSITE; PS50215; ADAM_MEPRO; 1 PROSITE; PS00427; DISINTEGRIN_1; 1 PROSITE; PS50214; DISINTEGRIN_2; 1 PROSITE; PS01186; EGF_2; 1 PROSITE; PS50026; EGF_3; 1 PROSITE; PS00142; ZINC_PROTEASE; 1 1: Evidence at protein level; 3D-structure; Alternative splicing; Complete proteome; Disulfide bond; EGF-like domain; Glycoprotein; Hydrolase; Membrane; Metal-binding; Metalloprotease; Polymorphism; Protease; Reference proteome; Signal; Transmembrane; Transmembrane helix; Zinc SIGNAL 1 16 CHAIN 17 824 Disintegrin and metalloproteinase domain- containing protein 8 /FTId=PRO_0000029060 TOPO_DOM 17 655 Extracellular. TRANSMEM 656 676 Helical. TOPO_DOM 677 824 Cytoplasmic. DOMAIN 200 400 Peptidase M12B. {ECO:0000255|PROSITE- ProRule:PRU00276} DOMAIN 408 494 Disintegrin. {ECO:0000255|PROSITE- ProRule:PRU00068} DOMAIN 609 641 EGF-like. {ECO:0000255|PROSITE- ProRule:PRU00076} ACT_SITE 335 335 {ECO:0000255|PROSITE-ProRule:PRU00276, ECO:0000255|PROSITE-ProRule:PRU10095} METAL 334 334 Zinc; catalytic METAL 338 338 Zinc; catalytic METAL 344 344 Zinc; catalytic CARBOHYD 67 67 N-linked (GlcNAc...) asparagine CARBOHYD 91 91 N-linked (GlcNAc...) asparagine CARBOHYD 436 436 N-linked (GlcNAc...) asparagine CARBOHYD 612 612 N-linked (GlcNAc...) asparagine DISULFID 310 395 DISULFID 351 379 DISULFID 353 362 DISULFID 435 457 {ECO:0000250|UniProtKB:Q10741} DISULFID 448 454 {ECO:0000250|UniProtKB:Q10741} DISULFID 466 486 {ECO:0000250|UniProtKB:Q10741} DISULFID 473 503 {ECO:0000250|UniProtKB:Q10741} DISULFID 498 508 {ECO:0000250|UniProtKB:Q10741} DISULFID 566 613 {ECO:0000250|UniProtKB:Q10741} DISULFID 613 623 DISULFID 617 629 DISULFID 631 640 VAR_SEQ 16 92 AIAPSRPWALMEQYEVVLPWRLPGPRVRRALPSHLGLHPER VSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANG -> G PAPREGELRPWGHRAQLHPPPAEEQGPAGLRLHRDLYGCQW LRGDGAASRAGPLLLPGPRRGVPGLSRQPQHLCRP (in isoform 2) /FTId=VSP_046154 VAR_SEQ 93 131 Missing (in isoform 2) /FTId=VSP_046155 VAR_SEQ 596 621 Missing (in isoform 2) /FTId=VSP_046156 VAR_SEQ 650 742 ASGSLPVFVVVVLVLLAVVLVTLAGIIVYRKARSRILSRNV APKTTMGRSNPLFHQAASRVPAKGGAPAPSRGPQELVPTTH PGQPARHPASS -> GCQPRAGQGRGSSPIQGPPRAGPHHP PGPARPTPGLLGGSEEAAPCSSGHCVQPTLPSSCLHPAGTK AGHQANVRTPSAPSQTRGWCGQPWSS (in isoform 3). /FTId=VSP_046157 VAR_SEQ 743 824 Missing (in isoform 3) /FTId=VSP_046158 VAR_SEQ 774 799 Missing (in isoform 2) /FTId=VSP_046159 VARIANT 35 35 W -> R (in dbSNP:rs2275725) /FTId=VAR_069144 VARIANT 101 101 G -> R (in dbSNP:rs11101675) /FTId=VAR_059760 VARIANT 189 189 R -> W (in dbSNP:rs45451297) /FTId=VAR_061735 VARIANT 433 433 R -> C (in dbSNP:rs12257830) /FTId=VAR_061736 VARIANT 657 657 F -> L (in dbSNP:rs2275720) /FTId=VAR_069145 VARIANT 775 775 I -> T (in dbSNP:rs3008319) /FTId=VAR_061737 CONFLICT 106 106 F -> L (in Ref. 1; BAA05626) CONFLICT 372 372 F -> L (in Ref. 2; BAG62738) CONFLICT 648 648 H -> D (in Ref. 2; BAG62738) STRAND 200 208 {ECO:0000244|PDB:4DD8} HELIX 210 216 {ECO:0000244|PDB:4DD8} HELIX 219 237 {ECO:0000244|PDB:4DD8} HELIX 238 240 {ECO:0000244|PDB:4DD8} STRAND 242 251 {ECO:0000244|PDB:4DD8} HELIX 264 276 {ECO:0000244|PDB:4DD8} TURN 279 281 {ECO:0000244|PDB:4DD8} STRAND 286 292 {ECO:0000244|PDB:4DD8} STRAND 302 304 {ECO:0000244|PDB:4DD8} STRAND 315 319 {ECO:0000244|PDB:4DD8} HELIX 325 339 {ECO:0000244|PDB:4DD8} HELIX 345 347 {ECO:0000244|PDB:4DD8} HELIX 378 387 {ECO:0000244|PDB:4DD8} HELIX 391 396 {ECO:0000244|PDB:4DD8} SEQUENCE 824 AA; 88771 MW; CE3D31330E153DB8 CRC64; MRGLGLWLLG AMMLPAIAPS RPWALMEQYE VVLPWRLPGP RVRRALPSHL GLHPERVSYV LGATGHNFTL HLRKNRDLLG SGYTETYTAA NGSEVTEQPR GQDHCFYQGH VEGYPDSAAS LSTCAGLRGF FQVGSDLHLI EPLDEGGEGG RHAVYQAEHL LQTAGTCGVS DDSLGSLLGP RTAAVFRPRP GDSLPSRETR YVELYVVVDN AEFQMLGSEA AVRHRVLEVV NHVDKLYQKL NFRVVLVGLE IWNSQDRFHV SPDPSVTLEN LLTWQARQRT RRHLHDNVQL ITGVDFTGTT VGFARVSAMC SHSSGAVNQD HSKNPVGVAC TMAHEMGHNL GMDHDENVQG CRCQERFEAG RCIMAGSIGS SFPRMFSDCS QAYLESFLER PQSVCLANAP DLSHLVGGPV CGNLFVERGE QCDCGPPEDC RNRCCNSTTC QLAEGAQCAH GTCCQECKVK PAGELCRPKK DMCDLEEFCD GRHPECPEDA FQENGTPCSG GYCYNGACPT LAQQCQAFWG PGGQAAEESC FSYDILPGCK ASRYRADMCG VLQCKGGQQP LGRAICIVDV CHALTTEDGT AYEPVPEGTR CGPEKVCWKG RCQDLHVYRS SNCSAQCHNH GVCNHKQECH CHAGWAPPHC AKLLTEVHAA SGSLPVFVVV VLVLLAVVLV TLAGIIVYRK ARSRILSRNV APKTTMGRSN PLFHQAASRV PAKGGAPAPS RGPQELVPTT HPGQPARHPA SSVALKRPPP APPVTVSSPP FPVPVYTRQA PKQVIKPTFA PPVPPVKPGA GAANPGPAEG AVGPKVALKP PIQRKQGAGA PTAP
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to
info@abgent.com, and receive a free "I Love Antibodies" mug.

Background

Possible involvement in extravasation of leukocytes.

FeedBack
Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at tech@abgent.com.

$ 80.00
Cat# BP14058a
Size:
Quantity:
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaCentral AmericaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSouth KoreaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamWorldwideOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
“Crown Flash”  50 % off on 2,500+ Crown Antibodies. PromoCode:<span class=text-red> FLASH50
Terms & Conditions