Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   IFT20 Antibody (Center) Blocking Peptide   

IFT20 Antibody (Center) Blocking Peptide

Synthetic peptide

Product Information
Primary Accession Q8IY31
Peptide ID 37938
Additional Information
Other Names Intraflagellar transport protein 20 homolog, hIFT20, IFT20
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Name IFT20
Function Part of intraflagellar transport (IFT) particles involved in ciliary process assembly. May play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium. Also involved in autophagy since it is required for trafficking of ATG16L and the expansion of the autophagic compartment.
Cellular Location Golgi apparatus, cis-Golgi network {ECO:0000250|UniProtKB:Q61025}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole {ECO:0000250|UniProtKB:Q61025}. Cytoplasm, cytoskeleton, cilium basal body {ECO:0000250|UniProtKB:Q61025}. Cell projection, cilium {ECO:0000250|UniProtKB:Q61025}. Note=Present at the centrosomes during the cell cycle and associated with the proximal portion of the mother centriole and the lateral aspect of the daughter centriole. Associated with basal body at the base of primary cilia (By similarity). {ECO:0000250|UniProtKB:Q61025}
Tissue Location Expressed in almost all tissues. EMBL; AY224601; AAP50265.1; -; mRNA EMBL; BQ639919; -; NOT_ANNOTATED_CDS; mRNA EMBL; AC002094; -; NOT_ANNOTATED_CDS; Genomic_DNA EMBL; BC002640; AAH02640.1; -; mRNA EMBL; BC038094; AAH38094.1; -; mRNA CCDS; CCDS32593.1; -. [Q8IY31-3] CCDS; CCDS58533.1; -. [Q8IY31-4] CCDS; CCDS58534.1; -. [Q8IY31-1] CCDS; CCDS58535.1; -. [Q8IY31-2] RefSeq; NP_001254703.1; NM_001267774.1. [Q8IY31-2] RefSeq; NP_001254704.1; NM_001267775.1. [Q8IY31-1] RefSeq; NP_001254705.1; NM_001267776.1. [Q8IY31-1] RefSeq; NP_001254706.1; NM_001267777.1. [Q8IY31-4] RefSeq; NP_001254707.1; NM_001267778.1 RefSeq; NP_777547.1; NM_174887.3. [Q8IY31-3] UniGene; Hs.705431; - UniGene; Hs.744876; - ProteinModelPortal; Q8IY31; - BioGrid; 124711; 36 IntAct; Q8IY31; 50 MINT; MINT-1193441; - STRING; 9606.ENSP00000350570; - iPTMnet; Q8IY31; - PhosphoSitePlus; Q8IY31; - BioMuta; IFT20; - DMDM; 74728279; - EPD; Q8IY31; - MaxQB; Q8IY31; - PaxDb; Q8IY31; - PeptideAtlas; Q8IY31; - PRIDE; Q8IY31; - TopDownProteomics; Q8IY31-3; -. [Q8IY31-3] DNASU; 90410; - Ensembl; ENST00000357896; ENSP00000350570; ENSG00000109083. [Q8IY31-3] Ensembl; ENST00000395418; ENSP00000378809; ENSG00000109083. [Q8IY31-1] Ensembl; ENST00000579419; ENSP00000463322; ENSG00000109083. [Q8IY31-4] Ensembl; ENST00000585089; ENSP00000464443; ENSG00000109083. [Q8IY31-2] Ensembl; ENST00000585313; ENSP00000463138; ENSG00000109083. [Q8IY31-1] GeneID; 90410; - KEGG; hsa:90410; - UCSC; uc002hau.3; human. [Q8IY31-1] CTD; 90410; - GeneCards; IFT20; - HGNC; HGNC:30989; IFT20 HPA; HPA021376; - MIM; 614394; gene neXtProt; NX_Q8IY31; - OpenTargets; ENSG00000109083; - PharmGKB; PA142671663; - eggNOG; ENOG410KC8U; Eukaryota eggNOG; ENOG4110P7T; LUCA GeneTree; ENSGT00390000003413; - HOGENOM; HOG000230527; - HOVERGEN; HBG081781; - InParanoid; Q8IY31; - KO; K16473; - OMA; QYEIFEQ; - OrthoDB; EOG091G0VSN; - PhylomeDB; Q8IY31; - TreeFam; TF319434; - Reactome; R-HSA-5620924; Intraflagellar transport ChiTaRS; IFT20; human GeneWiki; IFT20; - GenomeRNAi; 90410; - PRO; PR:Q8IY31; - Proteomes; UP000005640; Chromosome 17 Bgee; ENSG00000109083; - CleanEx; HS_IFT20; - ExpressionAtlas; Q8IY31; baseline and differential Genevisible; Q8IY31; HS GO; GO:0005814; C:centriole; IEA:UniProtKB-SubCell GO; GO:0005813; C:centrosome; IDA:MGI GO; GO:0097546; C:ciliary base; IEA:Ensembl GO; GO:0097542; C:ciliary tip; TAS:Reactome GO; GO:0005929; C:cilium; ISS:UniProtKB GO; GO:0005801; C:cis-Golgi network; IDA:SYSCILIA_CCNET GO; GO:0044292; C:dendrite terminus; IEA:Ensembl GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB GO; GO:0000139; C:Golgi membrane; TAS:Reactome GO; GO:0030992; C:intraciliary transport particle B; ISS:UniProtKB GO; GO:1902636; C:kinociliary basal body; IEA:Ensembl GO; GO:0005902; C:microvillus; IEA:Ensembl GO; GO:0031514; C:motile cilium; IEA:Ensembl GO; GO:0032391; C:photoreceptor connecting cilium; IEA:Ensembl GO; GO:0001750; C:photoreceptor outer segment; IEA:Ensembl GO; GO:0032420; C:stereocilium; IEA:Ensembl GO; GO:0017137; F:Rab GTPase binding; IPI:ParkinsonsUK-UCL GO; GO:0055007; P:cardiac muscle cell differentiation; IEA:Ensembl GO; GO:0051642; P:centrosome localization; IEA:Ensembl GO; GO:0060271; P:cilium assembly; IMP:UniProtKB GO; GO:0090102; P:cochlea development; IEA:Ensembl GO; GO:0001736; P:establishment of planar polarity; IEA:Ensembl GO; GO:0090002; P:establishment of protein localization to plasma membrane; IEA:Ensembl GO; GO:0060122; P:inner ear receptor stereocilium organization; IEA:Ensembl GO; GO:0042073; P:intraciliary transport; IEA:Ensembl GO; GO:0001822; P:kidney development; IEA:Ensembl GO; GO:0061351; P:neural precursor cell proliferation; IEA:Ensembl GO; GO:0036372; P:opsin transport; IEA:Ensembl GO; GO:0035845; P:photoreceptor cell outer segment organization; IEA:Ensembl GO; GO:0061512; P:protein localization to cilium; IEA:Ensembl GO; GO:0034067; P:protein localization to Golgi apparatus; IMP:MGI GO; GO:2000785; P:regulation of autophagosome assembly; ISS:UniProtKB GO; GO:0060828; P:regulation of canonical Wnt signaling pathway; IEA:Ensembl GO; GO:1902017; P:regulation of cilium assembly; ISS:UniProtKB GO; GO:0007224; P:smoothened signaling pathway; IEA:Ensembl GO; GO:0008542; P:visual learning; IEA:Ensembl InterPro; IPR028172; FT20 Pfam; PF14931; IFT20; 1 1: Evidence at protein level; Alternative splicing; Cell projection; Cilium; Cilium biogenesis/degradation; Coiled coil; Complete proteome; Cytoplasm; Cytoskeleton; Golgi apparatus; Reference proteome CHAIN 1 132 Intraflagellar transport protein 20 homolog /FTId=PRO_0000249303 REGION 70 132 IFT57-binding. COILED 74 114 VAR_SEQ 1 1 M -> MTHLLLTATVTPSEQNSSREPGWETAM (in isoform 2) /FTId=VSP_020390 VAR_SEQ 72 132 AIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYE ALCKVEAEQNEFIDQFIFQK -> SLAVSPRLECTGAISAH CKLCLSDSSDSPTSPSRVGGTTGHRCSELAQIYSKAERSST AATSSPNSRKENAARKVSG (in isoform 3) /FTId=VSP_020391 VAR_SEQ 107 132 YRVEYEALCKVEAEQNEFIDQFIFQK -> NELKISLL (in isoform 4) /FTId=VSP_046026 SEQUENCE 132 AA; 15281 MW; 8C751DE18FEEB30F CRC64; MAKDILGEAG LHFDELNKLR VLDPEVTQQT IELKEECKDF VDKIGQFQKI VGGLIELVDQ LAKEAENEKM KAIGARNLLK SIAKQREAQQ QQLQALIAEK KMQLERYRVE YEALCKVEAE QNEFIDQFIF QK
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


IFT20 is part of intraflagellar transport (IFT) particles involved in ciliary process assembly. IFT20 may play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium.


Follit, J.A., et al. Mol. Biol. Cell 17(9):3781-3792(2006)Jurczyk, A., et al. J. Cell Biol. 166(5):637-643(2004)Yin, G., et al. Mol. Biol. Rep. 30(4):255-260(2003)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 80.00
Cat# BP5133c
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown Flash17-30% Off
Terms & Conditions