Register or Login
  • All
  • Uniprot Id
  • Catalog #
  • Peptide Sequence
>   home   >   Products   >   Peptides   >   Blocking Peptides   >   DAOA Antibody (C-term) Blocking peptide   

DAOA Antibody (C-term) Blocking peptide

Synthetic peptide

Product Information
Primary Accession P59103
Other Accession NP_758958.3
Clone Names 90429096
Peptide ID 90429096
Additional Information
Other Names D-amino acid oxidase activator, Protein G72, DAOA, G72
Format Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 1 mg/ml.
StorageMaintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
PrecautionsThis product is for research use only. Not for use in diagnostic or therapeutic procedures.
Protein Information
Synonyms G72
Function Seems to activate D-amino acid oxidase.
Cellular Location Golgi apparatus.
Tissue Location Expressed in amygdala, caudate nucleus, spinal cord and testis EMBL; AE014294; AAN16027.1; -; Genomic_DNA EMBL; AE014294; AAN16028.1; -; Genomic_DNA EMBL; AY138546; AAN08432.1; -; mRNA EMBL; AY138547; AAN08433.1; -; mRNA EMBL; AY170469; AAO12727.1; -; mRNA EMBL; AY223901; AAO73604.1; -; mRNA EMBL; DQ343761; ABC59904.1; -; mRNA EMBL; DQ357223; ABC86111.1; -; mRNA EMBL; AL359751; CAH70815.1; -; Genomic_DNA EMBL; CH471085; EAX09080.1; -; Genomic_DNA EMBL; BC121091; AAI21092.1; -; mRNA CCDS; CCDS41905.1; -. [P59103-1] CCDS; CCDS53880.1; -. [P59103-3] RefSeq; NP_001155284.1; NM_001161812.1 RefSeq; NP_001155286.1; NM_001161814.1. [P59103-3] RefSeq; NP_758958.3; NM_172370.4. [P59103-1] RefSeq; XP_005254099.1; XM_005254042.1. [P59103-4] UniGene; Hs.381382; - ProteinModelPortal; P59103; - SMR; P59103; - IntAct; P59103; 1 MINT; MINT-8204618; - STRING; 9606.ENSP00000365103; - BioMuta; DAOA; - DMDM; 84028201; - PaxDb; P59103; - PRIDE; P59103; - Ensembl; ENST00000329625; ENSP00000329951; ENSG00000182346. [P59103-3] Ensembl; ENST00000375936; ENSP00000365103; ENSG00000182346. [P59103-1] Ensembl; ENST00000473269; ENSP00000470244; ENSG00000182346. [P59103-4] Ensembl; ENST00000559369; ENSP00000453831; ENSG00000182346. [P59103-3] Ensembl; ENST00000600388; ENSP00000472260; ENSG00000182346. [P59103-3] Ensembl; ENST00000618629; ENSP00000483757; ENSG00000182346. [P59103-1] GeneID; 267012; - KEGG; hsa:267012; - UCSC; uc001vqb.5; human. [P59103-1] CTD; 267012; - DisGeNET; 267012; - GeneCards; DAOA; - HGNC; HGNC:21191; DAOA HPA; HPA053114; - MalaCards; DAOA; - MIM; 607408; gene neXtProt; NX_P59103; - OpenTargets; ENSG00000182346; - PharmGKB; PA134924986; - eggNOG; ENOG410KIB9; Eukaryota eggNOG; ENOG4110QEM; LUCA GeneTree; ENSGT00410000028557; - HOGENOM; HOG000112142; - InParanoid; P59103; - OMA; ARNYEAS; - OrthoDB; EOG091G0PUQ; - PhylomeDB; P59103; - TreeFam; TF354179; - BioCyc; ZFISH:G66-30786-MONOMER; - GenomeRNAi; 267012; - PRO; PR:P59103; - Proteomes; UP000005640; Chromosome 13 CleanEx; HS_DAOA; - ExpressionAtlas; P59103; baseline and differential Genevisible; P59103; HS GO; GO:0005794; C:Golgi apparatus; IDA:UniProtKB GO; GO:0005739; C:mitochondrion; IDA:UniProtKB GO; GO:0048471; C:perinuclear region of cytoplasm; IDA:UniProtKB GO; GO:0008047; F:enzyme activator activity; IDA:UniProtKB GO; GO:0019899; F:enzyme binding; IPI:UniProtKB GO; GO:1900758; P:negative regulation of D-amino-acid oxidase activity; IDA:UniProtKB GO; GO:0043085; P:positive regulation of catalytic activity; IDA:UniProtKB InterPro; IPR027929; DAOA Pfam; PF15199; DAOA; 1 1: Evidence at protein level; Alternative splicing; Complete proteome; Golgi apparatus; Polymorphism; Reference proteome CHAIN 1 153 D-amino acid oxidase activator /FTId=PRO_0000079781 VAR_SEQ 1 71 Missing (in isoform 3) {ECO:0000303|PubMed:12647258, ECO:0000303|Ref.3} /FTId=VSP_044292 VAR_SEQ 16 16 S -> V (in isoform 2). /FTId=VSP_004053 VAR_SEQ 17 153 Missing (in isoform 2). /FTId=VSP_004054 VAR_SEQ 95 153 LEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYN QQKDQSCNHKEITSTKAE -> HSKVILNGNLHCHFKRISQ IFAGHFMEGDTEA (in isoform 4) /FTId=VSP_044293 VARIANT 30 30 R -> K (in dbSNP:rs2391191) /FTId=VAR_014313 VARIANT 62 62 K -> E (in dbSNP:rs9558562) /FTId=VAR_050943 SEQUENCE 153 AA; 18108 MW; 597E2DE432A48EAE CRC64; MLEKLMGADS LQLFRSRYTL GKIYFIGFQR SILLSKSENS LNSIAKETEE GRETVTRKEG WKRRHEDGYL EMAQRHLQRS LCPWVSYLPQ PYAELEEVSS HVGKVFMARN YEFLAYEASK DRRQPLERMW TCNYNQQKDQ SCNHKEITST KAE
Research Areas
Citations (0)

Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abgent to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.

Submit your citation using an Abgent antibody to, and receive a free "I Love Antibodies" mug.


DAOA is a protein that is an activator of theFAD-dependent enzyme D-amino acid oxidase, which degrades thegliotransmitter D-serine, a potent activator ofN-methyl-D-aspartate (NMDA) type glutamate receptors. Polymorphismsin this gene have been implicated in susceptibility toschizophrenia and bipolar affective disorder, possibly due todecreased levels of D-serine and decreased NMDA receptorfunctioning.


Schumacher, J., et al. Mol. Psychiatry 9(2):203-207(2004)Hillman, R.T., et al. Genome Biol. 5 (2), R8 (2004) :Hattori, E., et al. Am. J. Hum. Genet. 72(5):1131-1140(2003)Chumakov, I., et al. Proc. Natl. Acad. Sci. U.S.A. 99(21):13675-13680(2002)

Abgent welcomes feedback from its customers.

If you have used an Abgent product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.

If you have any additional inquiries please email technical services at

$ 80.00
Cat# BP5669b
Availability: In Stock
Bulk Size
Seasonal Special on Bulk Order
Request Quote Here

Ordering Information

United States
AlbaniaAustraliaAustriaBelgiumBosnia & HerzegovinaBrazilBulgariaCanadaChinaCroatiaCyprusCzech RepublicDenmarkEstoniaFinlandFranceGermanyGreeceHong KongHungaryIcelandIndiaIndonesiaIrelandIsraelItalyJapanKoreaLatviaLithuaniaLuxembourgMacedoniaMalaysiaMaltaNetherlandsNew ZealandNorwayPakistanPolandPortugalRomaniaSerbiaSingaporeSlovakiaSloveniaSouth AfricaSpainSwedenSwitzerlandTaiwanTurkeyUnited KingdomUnited StatesVietnamOthers
Abgent, Inc.
(888) 735-7227 / (858) 622-0099
(858) 622-0609
USA Headquarters
(888) 735-7227 / (858) 622-0099 or (858) 875-1900

Other Products

Shipping Information

Domestic orders (in stock items)
Shipped out the same day. Orders placed after 1 PM (PST) will ship out the next business day.
International orders
Contact your local distributors
Crown Flash17-30% Off
Terms & Conditions