GMF-gamma, human recombinant protein
Glia maturation factor gamma, GMF-gamma, GMFG, MGC126867
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | O60234 |
---|---|
Calculated MW | 16.8 kDa |
Gene ID | 9535 |
---|---|
Gene Symbol | GMFG |
Other Names | Glia maturation factor gamma, GMF-gamma, GMFG, MGC126867 |
Gene Source | Human |
Source | E. coli |
Assay&Purity | SDS-PAGE; ≥90% |
Assay2&Purity2 | HPLC; |
Recombinant | Yes |
Sequence | MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR |
Format | Liquid |
Storage | -20°C; Sterile Filtered colorless clear solution of GMF-gamma protein containing 20 mM Tris-HCl pH-8, 1mM DTT, 1mM EDTA and 10 % Glycerol. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
GMFG is a hematopoietic-specific protein that mediates the pluripotentiality and lineage commitment of human hematopoietic stem cells. Glia maturation factor gamma is a cytokine-responsive protein in EPO-induced and G-CSF-induced hematopoietic lineage development. Glia maturation factor also acts as a Nerve Growth Factor in nervous system development, angiogenesis and immune function. GMFG possesses hematopoietic tissue-specific gene expression, a promoter concentrated with high-score hematopoiesis-specific transcription factors, and molecular coevolution with a rudimentary blood/immune system. Glia Maturation Factor-Gamma (GMF-Gamma) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 142 amino acids and having a total molecular mass of 16.8 kDa. Glia Maturation Factor-Gamma, GMF-Gamma, Human Recombinant is purified by proprietary chromatographic techniques.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.