IL17 A/F, Mouse recombinant protein
Interleukin 17 A/F, IL-17A, IL-17F, Interleukin 17A, Interleukin 17F
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | Q62386 |
---|---|
Calculated MW | 30.7 kDa. |
Gene ID | 16171/257630 |
---|---|
Gene Symbol | IL17 A/F |
Other Names | Interleukin 17 A/F, IL-17A, IL-17F, Interleukin 17A, Interleukin 17F |
Gene Source | Mouse |
Source | E. coli |
Assay&Purity | SDS-PAGE; ≥98% |
Assay2&Purity2 | N/A; |
Recombinant | Yes |
Sequence | IL-17A subunit: MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA IL-17F subunit: MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREP |
Target/Specificity | IL17 A/F |
Application Notes | Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions. |
Format | Lyophilized |
Storage | -20°C; Lyophilized without any additives. |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
Background
Interleukin-17AF (IL-17AF) is a member of the IL-17 family of proteins produced by a subset of T cells, called Th17, following stimulation with IL-23. Since IL-17AF is thought to signal through the IL-17R receptor, its biological function is similar to that of IL-17A in that it induces the production of a variety of chemokines, in addition to airway neutrophilia. In regard to these functions, IL-17AF has less activity than the IL-17A homodimer but, greater activity than the IL-17F homodimer. Human and rat IL-17AF both show activity on mouse cells. Recombinant mouse IL-17AF is a non-glycosylated, disulfide-linked heterodimer. It is comprised of one monomeric subunit each of IL-17A and IL-17F, having a total of 271 amino acids and a molecular weight of 30.7 kDa.
References
Kennedy J.,et al.J. Interferon Cytokine Res. 16:611-617(1996).
Yao Z.,et al.Gene 168:223-225(1996).
Ivanov I.I.,et al.Cell 126:1121-1133(2006).
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.