GLP-1/Glucagon-Like Peptide, human
Synthetic Peptide
- SPECIFICATION
- CITATIONS
- PROTOCOLS
- BACKGROUND
Primary Accession | Q8MJ25 |
---|---|
Other Accession | P01274, P22890, P05110, P06883, P29794 |
Sequence | NH2-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-COOH |
Other Names | Glucagon, Glicentin, Glicentin-related polypeptide, GRPP, Oxyntomodulin, OXM, OXY, Glucagon, Glucagon-like peptide 1, GLP-1, Glucagon-like peptide 1(7-37), GLP-1(7-37), Glucagon-like peptide 1(7-36), GLP-1(7-36), Glucagon-like peptide 2, GLP-2, GCG |
---|---|
Format | Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed. |
Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. |
Precautions | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Name | GCG |
---|---|
Function | [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. |
Cellular Location | Secreted {ECO:0000250|UniProtKB:P01275}. |
Tissue Location | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from Abcepta to advance their research. Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
info@abcepta.com, and receive a free "I Love Antibodies" mug.
Provided below are standard protocols that you may find useful for product applications.
If you have used an Abcepta product and would like to share how it has performed, please click on the "Submit Review" button and provide the requested information. Our staff will examine and post your review and contact you if needed.
If you have any additional inquiries please email technical services at tech@abcepta.com.